General Information

  • ID:  hor004421
  • Uniprot ID:  Q8I6S2
  • Protein name:  Tachykinin-2
  • Gene name:  NA
  • Organism:  Octopus vulgaris (Common octopus)
  • Family:  Tachykinin family
  • Source:  animal
  • Expression:  Expressed in the posterior salivary gland and more specifically in the mucus-secreting gland cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Octopus (genus), Octopodidae (family), Incirrata (suborder), Octopoda (order), Octopodiformes (superorder), Coleoidea (subclass), Cephalopoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KPPSSSEFVGLM
  • Length:  12(38-49)
  • Propeptide:  MIRVGLILCCIFIVGVFEASSADDILTAHNLIKRSEVKPPSSSEFVGLMGRSEELTRRLIQHPGSMSETSKRGPPKKGDFNPNELKPESNIC
  • Signal peptide:  MIRVGLILCCIFIVGVFEASSA
  • Modification:  T12 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8I6S2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004421_AF2.pdbhor004421_ESM.pdb

Physical Information

Mass: 147485 Formula: C57H91N13O18S
Absent amino acids: ACDHINQRTWY Common amino acids: S
pI: 6.41 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -5.83 Boman Index: -733
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 56.67
Instability Index: 7605.83 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12576083
  • Title:  Isolation and Characterization of Novel Tachykinins From the Posterior Salivary Gland of the Common Octopus Octopus Vulgaris